.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yvw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of UDP-N-acetylglucosamine 1-carboxyvinyltransferase from Aquifex aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2yvw Target Id aae001001281.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12063, Molecular Weight 47257.08 Da.
    Residues 425 Isoelectric Point 6.79
    Sequence mknttlytyrdyfvirggkpltgkvkisgaknaalpimfatilteepctitnvpdlldvrntllllrel gaeleflnntvfinpsinsfitnqeiirrmrasvlslgpllgrfgravvglpggcsigarpidqhlkff keagadvevregyvyvnlkekrrvhfkfdlvtvtgtenallylasvpeesilenialepevmdlievlk kmgahvkvegrsayvkgsenlkgfthsvipdrieagtfmvgavltdgeillenarinhlravveklkli ggevveengnlrvfrkeslracdietqvypgfptdmqaqfmallsvakgksrikenifehrfhhaqeln rlganitvrgntayvegverlygsevystdlrasaslvlaglvaqgetvvrdvyhldrgyekleeklkk lgadiervsel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.81 Rfree 0.220
    Matthews' coefficent 3.09 Rfactor 0.195
    Waters 284 Solvent Content 60.20

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;EPU (URIDINE-DIPHOSPHATE-2(N-ACETYLGLUCOSAMINYL)) x 1
    Metals

    Jmol

     
    Google Scholar output for 2yvw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch