The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of APE1195. To be published
    Site RSGI
    PDB Id 2yvu Target Id ape001001195.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12103, Molecular Weight 21094.27 Da.
    Residues 186 Isoelectric Point 7.72
    Sequence mqalttykciekgivvwltglpgsgkttiatrladllqkegyrvevldgdwarttvsegagftreerlr hlkriawiarllarngvivicsfvspykqarnmvrriveeegipfleiyvkasleevirrdpkglykka lkgelenftgitdpyeppenpqlvldtesntiehnvsylyslvkavie
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.249
    Matthews' coefficent 2.42 Rfactor 0.202
    Waters 131 Solvent Content 49.25

    Ligand Information


    Google Scholar output for 2yvu

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch