.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yvs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glycolate oxidase subunit GlcE from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2yvs Target Id ttk003001266.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS23810, Molecular Weight 24169.61 Da.
    Residues 219 Isoelectric Point 9.95
    Sequence mevhaadqylvapgeadllevharlagtglfppfppvelpggvgglvarggfaqtfffpaevlgltfrt pkgrrvraggvvvknvqgydlvrlfvgsfgllgraeevvlrlrpgraqaflrrpfsgsfprlvptprfl faledeegpwlyayhfghpkeverfreafggeearpldlrprfprglglgegplwdlrfryqdggaspp pppaflrlarvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2493
    Matthews' coefficent 2.32 Rfactor 0.2079
    Waters 293 Solvent Content 47.05

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yvs

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch