.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yvo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for different substrate specificities of two ADP-ribose pyrophosphatases from Thermus thermophilus HB8. J.Bacteriol. 190 1108-1117 2008
    Site RSGI
    PDB Id 2yvo Target Id ttk003001256.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14671, Molecular Weight 20310.37 Da.
    Residues 182 Isoelectric Point 5.46
    Sequence mspwerilleeilsepvrlvkervrthtgreltyvyrpgpvaasfvlpvtergtallvrqyrhptgkfl levpagkvdegetpeaaarrelreevgaeaetliplpsfhpqpsftavvfhpflalkarvvtpptleeg elleslelpltevyallakgeiqdastaltlfyaephlkrlgll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.67 Rfree 0.205
    Matthews' coefficent 2.45 Rfactor 0.180
    Waters 138 Solvent Content 49.81

    Ligand Information
    Ligands AMP (ADENOSINE) x 1
    Metals MG (MAGNESIUM) x 3

    Jmol

     
    Google Scholar output for 2yvo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch