The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for different substrate specificities of two ADP-ribose pyrophosphatases from Thermus thermophilus HB8. J.Bacteriol. 190 1108-1117 2008
    Site RSGI
    PDB Id 2yvm Target Id ttk003001256.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14670, Molecular Weight 20310.37 Da.
    Residues 182 Isoelectric Point 5.46
    Sequence mspwerilleeilsepvrlvkervrthtgreltyvyrpgpvaasfvlpvtergtallvrqyrhptgkfl levpagkvdegetpeaaarrelreevgaeaetliplpsfhpqpsftavvfhpflalkarvvtpptleeg elleslelpltevyallakgeiqdastaltlfyaephlkrlgll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.225
    Matthews' coefficent 2.47 Rfactor 0.205
    Waters 129 Solvent Content 50.19

    Ligand Information
    Metals MG (MAGNESIUM) x 2


    Google Scholar output for 2yvm

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch