The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The interaction of DiaA and DnaA regulates the replication cycle in E. coli by directly promoting ATP DnaA-specific initiation complexes. Genes Dev. 21 2083-2099 2007
    Site RSGI
    PDB Id 2yva Target Id eco002003118.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12285, Molecular Weight 21072.77 Da.
    Residues 196 Isoelectric Point 5.31
    Sequence vqerikacftesiqtqiaaaealpdaisraamtlvqsllngnkilccgngtsaanaqhfaasminrfet erpslpaialntdnvvltaiandrlhdevyakqvralghagdvllaistrgnsrdivkaveaavtrdmt ivaltgydggelagllgpqdveiripshrsariqemhmltvnclcdlidntlfphqdd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.214
    Matthews' coefficent 2.09 Rfactor 0.183
    Waters 224 Solvent Content 41.10

    Ligand Information


    Google Scholar output for 2yva

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch