.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yv6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Novel dimerization mode of the human Bcl-2 family protein Bak, a mitochondrial apoptosis regulator. J.Struct.Biol. 166 32-37 2009
    Site RSGI
    PDB Id 2yv6 Target Id hss001003453.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13326, Molecular Weight 18435.87 Da.
    Residues 163 Isoelectric Point 5.26
    Sequence seeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvgrqlaiigddinrryds efqtmlqhlqptaenayeyftkiatslfesginwgrvvallgfgyrlalhvyqhgltgflgqvtrfvvd fmlhhciarwiaqrggwvaalnlgn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.248
    Matthews' coefficent 2.03 Rfactor 0.214
    Waters 19 Solvent Content 39.54

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2yv6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch