.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yv5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of YjeQ from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2yv5 Target Id ar_001000327.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12143, Molecular Weight 34743.34 Da.
    Residues 302 Isoelectric Point 6.32
    Sequence mgkkelkrglvvdreaqmigvylfedgktyrgiprgkvlkktkiyagdyvwgevvdpntfaieeveerk nllirpkvanvdrviivetlkmpefnnylldnmlvvyeyfkvepvivfnkidllneeekkelerwisiy rdagydvlkvsaktgegidelvdylegficilagpsgvgkssilsrltgeelrtqevsektergrhttt gvrlipfgkgsfvgdtpgfskveatmfvkprevrnyfreflryqckypdcthtnepgcavkeavkngei sceryksylkiikvyleeikelcred
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.207
    Matthews' coefficent 2.25 Rfactor 0.176
    Waters 218 Solvent Content 45.39

    Ligand Information
    Ligands GDP (GUANOSINE-5'-DIPHOSPHATE) x 1
    Metals ZN (ZINC) x 1;CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2yv5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch