.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yv3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Aspartate Semialdehyde Dehydrogenase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2yv3 Target Id ttk003000023.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14165, Molecular Weight 36077.57 Da.
    Residues 331 Isoelectric Point 6.12
    Sequence mrvavvgatgavgreilkvlearnfplselrlyasprsagvrlafrgeeipveplpegplpvdlvlasa gggisrakalvwaeggalvvdnssawryepwvplvvpevnrekifqhrgiianpncttailamalwplh rafqakrvivatyqaasgagakameelltethrflhgeapkaeafahplpfnviphidafqengytree mkvvwethkifgddtirisatavrvptlrahaeavsvefarpvtpeaarevlkeapgvevvdepeakry pmpltasgkwdvevgrirkslafengldffvvgdqllkgaalnavqiaeewlkga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.368
    Matthews' coefficent 3.64 Rfactor 0.303
    Waters 45 Solvent Content 66.23

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yv3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch