.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yv1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Succinyl-CoA Synthetase Alpha Chain from Methanocaldococcus jannaschii DSM 2661. To be Published
    Site RSGI
    PDB Id 2yv1 Target Id mja001001246.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13379, Molecular Weight 30921.35 Da.
    Residues 294 Isoelectric Point 5.78
    Sequence mvlrdkmilldentkaivqgitgrqgsfhtkkmlecgtkivggvtpgkggqnvhgvpvfdtvkeavket danasvifvpapfakdavfeaidagielivvitehipvhdtmefvnyaedvgvkiigpntpgiaspkvg klgiipmevlkegsvgmvsrsgtltyeiahqikkagfgvstcvgiggdpivglrykevldlfekddete aivmigeigggaeeeaakfiekmkkpvigyiagqsapegkrmghagaivekgkgtaeskmkaleeagay vaknisdipkllagilgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.238
    Matthews' coefficent 2.28 Rfactor 0.205
    Waters 271 Solvent Content 46.08

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yv1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch