The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of 2nd Immunoglobulin Domain of Slow Type Myosin-Binding Protein C. To be Published
    Site RSGI
    PDB Id 2yuv Target Id hso002000567.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12922, Molecular Weight 10083.00 Da.
    Residues 87 Isoelectric Point 6.81
    Sequence aafakildpayqvdkggrvrfvveladpklevkwykngqeirpstkyifehkgcqrilfinncqmtdds eyyvtagdekcstelfvr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2yuv

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch