.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yus

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SANT domain of human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1. To be Published
    Site RSGI
    PDB Id 2yus Target Id hsk003000926.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12831, Molecular Weight 7621.08 Da.
    Residues 66 Isoelectric Point 4.63
    Sequence tlakskgasagrewteqetllllealemykddwnkvsehvgsrtqdecilhflrlpiedpylensd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yus

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch