.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yum

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the Myb-like DNA-binding domain of human ZZZ3 protein. To be Published
    Site RSGI
    PDB Id 2yum Target Id hsi002027679.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12558, Molecular Weight 7296.11 Da.
    Residues 62 Isoelectric Point 9.40
    Sequence nqlwtveeqkkleqllikyppeevesrrwqkiadelgnrtakqvasqvqkyfikltkagipv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yum

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch