The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of human ubiquitin fusion degradation protein 1 homolog UFD1. To be Published
    Site RSGI
    PDB Id 2yuj Target Id hso003008466.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13109, Molecular Weight 20734.75 Da.
    Residues 183 Isoelectric Point 4.93
    Sequence iprvfqnrfstqyrcfsvsmlagpndrsdvekggkiimppsaldqlsrlnitypmlfkltnknsdrmth cgvlefvadegicylphwmmqnllleegglvqvesvnlqvatyskfqpqspdflditnpkavlenalrn faclttgdviainynekiyelrvmetkpdkavsiiecdmnvdfda
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2yuj

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch