The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the N-terminal domain in human cytokine-induced apoptosis inhibitor anamorsin. To be Published
    Site RSGI
    PDB Id 2yui Target Id hsi002004051.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12363, Molecular Weight 18185.84 Da.
    Residues 169 Isoelectric Point 5.40
    Sequence madfgisagqfvavvwdksspvealkglvdklqaltgnegrvsvenikqllqsahkessfdiilsglvp gsttlhsaeilaeiarilrpggclflkepvetavdnnskvktasklcsaltlsglvevkelqrepltpe evqsvrehlghesdnllfvqitgkkpnfevg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2yui

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch