.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yug

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of mouse FRG1 protein. To be Published
    Site RSGI
    PDB Id 2yug Target Id mmt008005327.3
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13660, Molecular Weight 16090.22 Da.
    Residues 148 Isoelectric Point 4.76
    Sequence ldivgiwwtvsnfgeisgtiaiemdkgayihaldnglftlgaphrevdegpsppeqftavklsdsrial ksgygkylginsdglvvgrsdaigpreqwepvfqdgkmallasnscfircneagdieaknktageeemi kirscaeret
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yug

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch