.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yud

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the YTH domain in YTH domain-containing protein 1 (Putative splicing factor YT521). To be Published
    Site RSGI
    PDB Id 2yud Target Id hsk002101933.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12786, Molecular Weight 19687.84 Da.
    Residues 173 Isoelectric Point 9.78
    Sequence vravrkdqtsklkyvlqdarffliksnnhenvslakakgvwstlpvnekklnlafrsarsvilifsvre sgkfqgfarlsseshhggspihwvlpagmsakmlggvfkidwicrrelpftksahltnpwnehkpvkig rdgqeielecgtqlcllfppdesidlyqvihkmrh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yud

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch