The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SP-RING domain in non-SMC element 2 homolog (MMS21, S. cerevisiae). To be Published
    Site RSGI
    PDB Id 2yu4 Target Id hsi002021786.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12535, Molecular Weight 9617.63 Da.
    Residues 81 Isoelectric Point 9.57
    Sequence ftcpitkeemkkpvknkvcghtyeedaivrmiesrqkrkkkaycpqigcshtdirksdliqdealrrai enhnkkrhrhse
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 1


    Google Scholar output for 2yu4

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch