.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ytz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of tRNA N(2),N(2)-Guanosine Dimethyltransferase Trm1 from Pyrococcus horikoshii. J.Mol.Biol. 383 871-884 2008
    Site RSGI
    PDB Id 2ytz Target Id pho001001829.5
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14012, Molecular Weight 43268.95 Da.
    Residues 381 Isoelectric Point 8.67
    Sequence mvnlelievqegkakilipkaesiydspvfynprmalnrdivvvllnilnpkivldalsatgirgirfa letpaeevwlndisedayelmkrnvmlnfdgelreskgrailkgektivinhddanrlmaerhryfhfi dldpfgspmefldtalrsakrrgilgvtatdgaplcgahpraclrkylavplrgelchevgtrilvgvi aryaakydlgidvilayykdhyfrafvklkdgarkgdetleklgyiyfddktgkfeleqgflptrpnay gpvwlgplkdekivskmvkeaeslslarkkqalkllkmidqeldiplfydthaigrrlkietkkveeii salreqgyeatrthfsptgiktsapyevfietikri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.65 Rfree 0.246
    Matthews' coefficent 3.05 Rfactor 0.19
    Waters 272 Solvent Content 59.72

    Ligand Information
    Ligands SO4 (SULFATE) x 4;SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2ytz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch