The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the C2H2 type zinc finger (region 479-511) of human Zinc finger protein 224. To be Published
    Site RSGI
    PDB Id 2yth Target Id hso003012948.16
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13155, Molecular Weight 3820.04 Da.
    Residues 33 Isoelectric Point 7.86
    Sequence sgekpfqceecgkrftqnshlhshqrvhtgekp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 1


    Google Scholar output for 2yth

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch