.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yt8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the PDZ domain of Amyloid beta A4 precursor protein-binding family A member 3 (Neuron- specific X11L2 protein) (Neuronal Munc18-1-interacting protein 3) (Mint-3) (Adapter protein X11gamma). To be Published
    Site RSGI
    PDB Id 2yt8 Target Id ar_001000806.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12220, Molecular Weight 9466.49 Da.
    Residues 87 Isoelectric Point 8.06
    Sequence vttaiihrphareqlgfcvedgiicsllrggiaerggirvghriieingqsvvatphariiellteayg evhiktmpaatyrlltgq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yt8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch