.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ysw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the 3-dehydroquinate dehydratase from Aquifex aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2ysw Target Id aae001000021.2
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12018, Molecular Weight 24969.43 Da.
    Residues 219 Isoelectric Point 5.90
    Sequence mliavplddtnfsenlkkakekgadivelrvdqfsdtslnyvkekleevhsqglktiltirspeeggre vknreelfeelsplsdytdielssrgllvklynitkeagkkliisyhnfeltppnwiirevlregyryg gipkiavkansyedvarllcisrqvegekilismgdygkisrlagyvfgsvitycslekafapgqiple emvelrkkfyrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.25 Rfree 0.250
    Matthews' coefficent 3.13 Rfactor 0.218
    Waters 231 Solvent Content 60.64

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ysw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch