The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SH3 domain from Rho guanine nucleotide exchange factor 9. To be Published
    Site RSGI
    PDB Id 2ysq Target Id hsk002100413.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12708, Molecular Weight 7838.19 Da.
    Residues 68 Isoelectric Point 4.04
    Sequence dsivsaeavwdhvtmanrelafkagdvikvldasnkdwwwgqiddeegwfpasfvrlwvnqedeveeg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2ysq

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch