The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RING domain (1-66) from tripartite motif-containing protein 31. To be Published
    Site RSGI
    PDB Id 2ysl Target Id hss001001094.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13237, Molecular Weight 7335.36 Da.
    Residues 66 Isoelectric Point 8.48
    Sequence masgqfvnklqeevicpicldilqkpvtidcghnfclkcitqigetscgffkcplcktsvrknair
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 2ysl

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch