The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the DnaJ-like domain from human ras-associated protein Rap1. To be Published
    Site RSGI
    PDB Id 2ys8 Target Id hsi002022234.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12538, Molecular Weight 8455.22 Da.
    Residues 77 Isoelectric Point 9.84
    Sequence ssasftkeqadairrirnskdswdmlgvkpgasrdevnkayrklavllhpdkcvapgsedafkavvnar tallknik
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2ys8

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch