The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2. J.STRUCT.FUNCT.GENOM. 2010
    Site RSGI
    PDB Id 2ys5 Target Id hsi002009654.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12421, Molecular Weight 15794.00 Da.
    Residues 139 Isoelectric Point 5.53
    Sequence lnrdsvpdnhptkfkvtnvddegvelgsgvmeltqselvlhlhrreavrwpylclrrygydsnlfsfes grrcqtgqgifafkcsraeeifnllqdlmqcnsinvmeepviitrnshpaeldlprapqppnalgytvss
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2ys5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch