.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ys4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the N-terminal PapD-like domain of HYDIN protein from human. To be Published
    Site RSGI
    PDB Id 2ys4 Target Id hsi002011753.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12458, Molecular Weight 12804.12 Da.
    Residues 115 Isoelectric Point 7.65
    Sequence terekfivpikargaraildfpdklnfstcpvkystqkillvrnignknavfhiktcrpfsiepaigtl nvgesmqlevefepqsvgdhsgrlivcydtgekvfvslygaaidmn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ys4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch