The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the CHORD domain of human CHORD-containing protein 1. To be Published
    Site RSGI
    PDB Id 2yrt Target Id hso003007212.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13103, Molecular Weight 7644.18 Da.
    Residues 68 Isoelectric Point 7.62
    Sequence mallcynrgcgqrfdpetnsddactyhpgvpvfhdalkgwscckrrttdfsdflsivgctkgrhnsek
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 2yrt

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch