.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yrp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the TIG domain from Human Nuclear factor of activated T-cells, cytoplasmic 4. To be Published
    Site RSGI
    PDB Id 2yrp Target Id hso002102313.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13027, Molecular Weight 12137.11 Da.
    Residues 107 Isoelectric Point 7.97
    Sequence lpqveayspsacsvrggeelvltgsnflpdskvvfiergpdgklqweeeatvnrlqsnevtltltvpey snkrvsrpvqvyfyvsngrrkrsptqsfrflpvickee
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yrp

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch