The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the fourth Ig-like domain from myosin light chain kinase, smooth muscle. To be Published
    Site RSGI
    PDB Id 2yr3 Target Id hsb001012216.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12317, Molecular Weight 9930.72 Da.
    Residues 92 Isoelectric Point 4.66
    Sequence mevapsfssvlkdcaviegqdfvlqcsvrgtpvpritwllngqpiqyarstceagvaelhiqdalpedh gtytclaenalgqvscsawvtvh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2yr3

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch