The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical regulator from Sulfolobus tokodaii. To be Published
    Site RSGI
    PDB Id 2yr2 Target Id sto001001710.2
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14057, Molecular Weight 16854.62 Da.
    Residues 146 Isoelectric Point 6.41
    Sequence mlesnenriqimstiakiyramsrelnrrlgelnlsyldflvlratsdgpktmaylanryfvtqsaita svdkleemglvvrvrdredrrkilieitekgletfnkgieiykklanevtgdlsedevilvldkiskil krieeisq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.01 Rfree 0.279
    Matthews' coefficent 2.20 Rfactor 0.234
    Waters 261 Solvent Content 44.06

    Ligand Information
    Metals ZN (ZINC) x 1


    Google Scholar output for 2yr2

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch