.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yr0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Hypothetical Methyltransferase TTHA0223 from Thermus thermophilus HB8. To be published
    Site RSGI
    PDB Id 2yr0 Target Id ttk003001374.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14707, Molecular Weight 29640.59 Da.
    Residues 263 Isoelectric Point 7.09
    Sequence mssallraayaydrlrahppevagqiatamasavhpkgeepvflelgvgtgrialpliargyryialda daamlevfrqkiagvdrkvqvvqadaraiplpdesvhgvivvhlwhlvpdwpkvlaeairvlkpggall egwdqaeaspewtlqerwrafaaeegfpverglhakrlkeveealrrlglkprtrevarwreertprea lealserlysftqglpepvharvmerlwawaeaelgdldrpfpvekrfllrvsrlg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.276
    Matthews' coefficent 2.21 Rfactor 0.245
    Waters 191 Solvent Content 44.29

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yr0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch