.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yqr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the KH domain in KIAA0907 protein. To be Published
    Site RSGI
    PDB Id 2yqr Target Id hsk002100884.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12738, Molecular Weight 12297.55 Da.
    Residues 112 Isoelectric Point 7.13
    Sequence gmhyvqdklfvglehavptfnvkekvegpgcsylqhiqietgakvflrgkgsgciepasgreafepmyi yishpkpeglaaakklcenllqtvhaeysrfvnqintavplpg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yqr

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch