The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site RSGI
    PDB Id 2yqn Target Id ar_001000690.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12207, Molecular Weight 404449.30 Da.
    Residues 3703 Isoelectric Point 5.83
    Sequence megcdspvvsgkdngcgipqhqqwtelnsthlpdkpssmeqstgeshgpldslrapfnerlaestasag ppaepaskevtcnecsasfaslqtymehhcpsarpppplreesasdtgeegdeesdvenlageivyqpd gsayiveslsqltqgggacgsgsgsgplpslflnslpgaggkqgdpscaapvypqiintfhiassfgkw fegpdqafpntsalaglspvlhsfrvfdvrhksnkdylnsdgsaksscvskdvpnnvdlskfdgfvlyg krkpilmcflcklsfgyvrsfvthavhdhrmtlsederkilsnknisaiiqgigkdkeplvsflepknk nfqhplvstanligpghsfygkfsgirmegeealpagsaagpeqpqaglltpstllnlggltssvlktp itsvplgalassptkssegkdsgaaegekqevgdgdcfsekvepaeeeaeeeeeeeeaeeeeeeeeeee eeeedegckglfpseldeeledrpheepgaaagssskkdlalsnqsisnsplmpnvlqtlsrgtastss nsassfvvfdganrrnrlsfnsegvrtnvaeggrrldfadesankdnatapepnestegddggfvphhq hagslcelgvgecpsgsgvecpkcdtvlgssrslgghmtmmhsrnscktlkcpkcnwhykyqqtleahm kekhpepggscvycksgqphprlargesytcgykpfrcevcnystttkgnlsihmqsdkhlnnmqnlqn gggeqvfihtagaaaaaaaaaaaaanissscgapsptkpktkptwrcevcdyetnvarnlrihmtsekh mhnmmllqqnmtqiqhnhhrvlgslpspaeaelyqyylaqnmnlpnlkmdsaasdaqfmmsgfqldpag pmaamtpalvggeipldmrlgggqlvseelmnlgesfiqtndpslklfqcavcnkfttdnldmlglhmn verslsedewkavmgdsyqcklcryntqlkanfqlhcktdkhvqkyqlvahikeggkanewrlkcvaig npvhlkcnacdyytnsleklrlhtvnsrheaslklykhlqqhesgvegescyyhcvlcnystkaklnli qhvrsmkhqrseslrklqrlqkglpeededlgqiftirrcpstdpeeaiedvegpsetaadpeelakdq eggasssqaekeltdspatskrisfpgssesplsskrpktaeeikpeqmyqcpyckysnadvnrlrvha mtqhsvqpmlrcplcqdmlnnkihlqlhlthlhsvapdcveklimtvttpemvmpssmflpaavpdrdg nsnleeagkqpetsedlgknilpsasteqsgdlkpspadpgsvredsgficwkkgcnqvfktsaalqth fnevhakrpqlpvsdrhvykyrcnqcslafktieklqlhsqyhviraatmcclcqrsfrtfqalkkhle tshlelseadiqqlyggllangdllamgdptlaedhtiiveedkeeesdledkqsptgsdsgsvqedsg sepkralpfrkgpnftmekfldpsrpykctvckesftqknillvhynsvshlhklkralqesatgqpep tsspdnkpfkcntcnvaysqsstleihmrsvlhqtkaraakleaasgssngtgnsssislssstpspvs tsgsntfttsnpssagiapssnllsqvptesvgmpplgnpiganiaspsepkeanrkkladmiasrqqq qqqqqqqqqqqqqqqqaqtlaqaqaqvqahlqqelqqqaaliqsqlfnptllphfpmttetllqlqqqq hllfpfyipsaefqlnpevslpvtsgaltltgtgpglledlkaqvqvpqqshqqilpqqqqnqlsiaqs hsallqpsqhpekknklvikekekesqrerdsaeggegntgpketlpdalkakekkelapgggsepsml ppriasdargnatkallenfgfelviqynenkqkvqkkngktdqgenleklecdscgklfsnililksh qehvhqnyfpfkqlerfakqyrdhydklyplrpqtpepppppppppppplpaappqpastpaipasapp itsptiapaqpsvpltqlsmpmelpifsplmmqtmplqtlpaqlppqlgpveplpadlaqlyqhqlnpt llqqqnkrprtritddqlrvlrqyfdinnspseeqikemadksglpqkvikhwfrntlfkerqrnkdsp ynfsnppitsleelkidsrppspeppkqeywgskrssrtrftdyqlrvlqdffdanaypkddefeqlsn llnlptrvivvwfqnarqkarknyenqgegkdgerreltndryirtsnlnyqckkcslvfqrifdlikh qkklcykdedeegqddsqnedsmdameiltptssscstpmpsqaysapapsanntassaflqltaeaee latfnskteagdekpklaeapsaqpnqtqekqgqpkpelqqqeqpeqktntpqqklpqlvslpslpqpp pqapppqcplpqsspspsqlshlplkplhtstpqqlanlppqlipyqcdqcklafpsfehwqehqqlhf lsaqnqfihpqfldrsldmpfmlfdpsnpllasqllsgaipqipassatspstptstmntlkrkleeka saspgendsgtggeepqrdkrlrttitpeqleilyqkylldsnptrkmldhiahevglkkrvvqvwfqn trarerkgqfravgpaqahrrcpfcralfkaktaleahirsrhwheakragynltlsamlldcdgglqm kgdifdgtsfshlppsssdgqgvplspvsktmelsprtllspssikvegiedfespsmssvnlnfdqtk ldnddcssvntaitdtttgdegnadndsatgiatetksssapnegltkaammamseyedrlssglvspa psfyskeydnegtvdysetssladpcspspgasgsagksgdsgdrpgqkrfrtqmtnlqlkvlkscfnd yrtptmlecevlgndiglpkrvvqvwfqnarakekksklsmakhfginqtsyegpktectlcgikysar lsvrdhifsqqhiskvkdtigsqldkekeyfdpatvrqlmaqqeldrikkanevlglaaqqqgmfdntp lqalnlptaypalqgippvllpglnspslpgftpsntaltspkpnlmglpsttvpspglptsglpnkps saslssptpaqatmamgpqqppqqqqqqqqpqvqqpppppaaqppptpqlplqqqqqrkdkdsekvkek ekahkgkgeplpvpkkekgeaptataatisaplptmeyavdpaqlqalqaaltsdptalltsqflpyfv pgfspyyapqipgalqsgylqpmygmeglfpyspalsqalmglspgsllqqyqqyqqslqeaiqqqqqr qlqqqqqqkvqqqqpkasqtpvppgapspdkdpakespkpeeqkntprevspllpklpeepeaesksad slydpfivpkvqyklvcrkcqagfsdeeaarshlkslcffgqsvvnlqemvlhvptggggggsgggggg ggggggggsyhclacesalcgeealsqhlesalhkhrtitraarnakehpsllphsacfpdpstastsq saahsndsppppsaaapssasphasrkswpqvvsrasaakppsfpplsssstvtssscstsgvqpsmptddyseesdtdlsqksdgpaspvegpkdpscpkdsgltsvgtdtfrl
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information


    Google Scholar output for 2yqn

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch