.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yqk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SANT domain in Arginine-glutamic acid dipeptide (RE) repeats. To be Published
    Site RSGI
    PDB Id 2yqk Target Id hsk002100446.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12713, Molecular Weight 6294.05 Da.
    Residues 50 Isoelectric Point 9.56
    Sequence iekcwtedevkrfvkglrqygknffrirkellpnketgelitfyyywkkt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2yqk

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch