The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structures of the first and second RNA-binding domains of human U2 small nuclear ribonucleoprotein particle auxiliary factor (U2AF(65)). EMBO J. 18 4523-4534 1999
    Site RSGI
    PDB Id 2u2f Target Id ar_001000504.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12173, Molecular Weight 9085.94 Da.
    Residues 85 Isoelectric Point 8.10
    Sequence ahklfigglpnylnddqvkelltsfgplkafnlvkdsatglskgyafceyvdinvtdqaiaglngmqlg dkkllvqrasvgakna
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2u2f

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch