.
The Open Protein Structure Annotation Network
PDB Keyword
.

2sxl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A characteristic arrangement of aromatic amino acid residues in the solution structure of the amino-terminal RNA-binding domain of Drosophila sex-lethal. J.Mol.Biol. 272 82-94 1997
    Site RSGI
    PDB Id 2sxl Target Id my_001000017.1
    Molecular Characteristics
    Source Drosophila melanogaster
    Alias Ids TPS13680, Molecular Weight 10047.97 Da.
    Residues 88 Isoelectric Point 9.56
    Sequence asntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysygyafvdftsemdsqraikvlngit vrnkrlkvsyarpggesik
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2sxl

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch