.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qq3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of Enoyl-CoA Hydrates Subunit I (gk_2039) Other Form From Geobacillus Kaustophilus HTA426. To be Published
    Site RSGI
    PDB Id 2qq3 Target Id gka001002039.2
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12310, Molecular Weight 28585.61 Da.
    Residues 260 Isoelectric Point 5.74
    Sequence ghmsefvsiaarqegavgiielarpdvlnalsrqmvaeivaaveafdrnekvrvivltgrgrafaagad iqemakddpirlewlnqfadwdrlsivktpmiaavnglalgggfelalscdlivassaaefgfpevnlg vmpgaggtqrltkligpkralewlwtgarmsakeaeqlgivnrvvspellmeetmrlagrlaeqpplal rlikeavqkavdyplyegmqferknfyllfasedqkegmaaflekrkprfqgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 1.95 Rfree 0.223
    Matthews' coefficent 2.10 Rfactor 0.184
    Waters 1988 Solvent Content 41.49

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 13
    Metals

    Jmol

     
    Google Scholar output for 2qq3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch