The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of Molybdenum Cofactor Biosynthesis (aq_061) Other Form From Aquifex Aeolicus Vf5. To be Published
    Site RSGI
    PDB Id 2qq1 Target Id aae001000061.2
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12021, Molecular Weight 19274.47 Da.
    Residues 178 Isoelectric Point 5.64
    Sequence msekkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektlieladekgc slilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsrqtagirgsclivnlpgkp qsikvcldavmpaipycidliggayidtdpnkvkafrpkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.90 Rfree 0.242
    Matthews' coefficent 2.13 Rfactor 0.206
    Waters 1022 Solvent Content 42.17

    Ligand Information


    Google Scholar output for 2qq1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch