.
The Open Protein Structure Annotation Network
PDB Keyword
.

2px7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2px7 Target Id ttk003000235.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14302, Molecular Weight 25188.45 Da.
    Residues 236 Isoelectric Point 6.56
    Sequence mghhhhhhhhhhssghiddddkhmevsvlipaagnglrlgrgpkaflqvggrtllewtlaafrdaaevl valppgaeppkglgavfleggatrqasvarlleaaslplvlvhdvarpfvsrglvarvleaaqrsgaav pvlpvpdtlmapegeaygrvvpreafrlvqtpqgfftallreahayarrkgleasddaqlvqalgypva lvegeatafkithpqdlvlaealarvwsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.248
    Matthews' coefficent 3.34 Rfactor 0.227
    Waters 160 Solvent Content 63.15

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2px7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch