.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pw6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized protein JW3007 from Escherichia coli K12. To be Published
    Site RSGI
    PDB Id 2pw6 Target Id eco002003007.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12284, Molecular Weight 30421.21 Da.
    Residues 278 Isoelectric Point 5.47
    Sequence gssgssgmtplvkdiimsstrmpalflghgspmnvlednlytrswqklgmtlprpqaivvvsahwftrg tgvtametpptihdfggfpqalydthypapgspalaqrlvellapipvtldkeawgfdhgswgvlikmy pdadipmvqlsidsskpaawhfemgrklaalrdegimlvasgnvvhnlrtvkwhgdsspypwatsfney vkanltwqgpveqhplvnyldheggtlsnptpehylpllyvlgawdgqepitipvegiemgslsmlsvqig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.27 Rfree 0.2667
    Matthews' coefficent 2.85 Rfactor 0.23457
    Waters 51 Solvent Content 56.83

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 3

    Jmol

     
    Google Scholar output for 2pw6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch