The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Hyopthetical protein (gk_1056) from geobacillus Kaustophilus HTA426. To be Published
    Site RSGI
    PDB Id 2pq0 Target Id gka001001056.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12297, Molecular Weight 29626.62 Da.
    Residues 260 Isoelectric Point 6.60
    Sequence ghmgrkivffdidgtlldeqkqlplstieavrrlkqsgvyvaiatgrapfmfehvrkqlgidsfvsfng qyvvfegnvlykqplrrekvralteeahknghplvfmdaekmrasigdhphihvsmaslkfahppvdpl yyenkdiyqallfcraeeeepyvrnypefrfvrwhdvstdvlpaggskaegirmmieklgidkkdvyaf gdglndiemlsfvgtgvamgnaheevkrvadfvtkpvdkegiwyglkqlqlir
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.241
    Matthews' coefficent 4.96 Rfactor 0.208
    Waters 352 Solvent Content 75.19

    Ligand Information


    Google Scholar output for 2pq0

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch