.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pg0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of acyl-CoA dehydrogenase from G. kaustophilus. To be Published
    Site RSGI
    PDB Id 2pg0 Target Id gka001001316.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12301, Molecular Weight 43529.76 Da.
    Residues 385 Isoelectric Point 6.42
    Sequence glnhmtarylreehhmfraafrkflekeayphyndwekrgiiprsfwakmgengflcpwvdekygglna dfaysvvineelekvgsslvgiglhndivtpyiasygteeqkqkwlpkcvtgelitaiamtepgagsdl anisttavkdgdyyivngqktfitngihadlivvacktdpqakpphrgisllvverdtpgftrgrklek vglhaqdtaelffqdakvpaynllgeegkgfyylmeklqqerlvvaiaaqtaaevmfsltkqyvkqrta fgkrvsefqtvqfrlaemateialgrtfvdrvieehmagkqivtevsmakwwitemakrvaaeamqlhg gygymeeyeiarryrdipvsaiyagtnemmktiiarqldl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.226
    Matthews' coefficent 2.93 Rfactor 0.205
    Waters 566 Solvent Content 58.03

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2pg0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch