The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of frv operon protein frvx (ph1821)from pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2pe3 Target Id pho001001821.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14008, Molecular Weight 39005.80 Da.
    Residues 354 Isoelectric Point 5.25
    Sequence mdlkggesmvdwklmqeiieapgvsgyehlgirdivvdvlkevadevkvdklgnviahfkgssprimva ahmdkigvmvnhidkdgylhivpiggvlpetlvaqrirfftekgerygvvgvlpphlrrgqedkgskid wdqivvdvgasskeeaeemgfrvgtvgefapnftrlnehrfatpylddriclyamieaarqlgdheadi yivgsvqeevglrgarvasyainpevgiamdvtfakqphdkgkivpelgkgpvmdvgpninpklrafad evakkyeiplqvepsprptgtdanvmqinregvatavlsipirymhsqveladardvdntiklakalle elkpmdftp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.197
    Matthews' coefficent 2.69 Rfactor 0.166
    Waters 595 Solvent Content 54.33

    Ligand Information


    Google Scholar output for 2pe3

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch