.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pcr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Myo-inositol-1(or 4)-monophosphatase (aq_1983) from Aquifex Aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2pcr Target Id aae001001983.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12089, Molecular Weight 29352.46 Da.
    Residues 264 Isoelectric Point 5.46
    Sequence menlkkylevakiaalaggqvlkenfgkvkkenieekgekdfvsyvdktseerikevilkffpdhevvg eemgaegsgseyrwfidpldgtknyingfpifavsvglvkgeepivgavylpyfdklywgakglgayvn gkrikvkdneslkhagvvygfpsrsrrdisiylnifkdvfyevgsmrrpgaaavdlcmvaegifdgmme femkpwditaglvilkeaggvytlvgepfgvsdiiagnkalhdfmlqvakkymevav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.60 Rfree 0.247
    Matthews' coefficent 2.39 Rfactor 0.19
    Waters 312 Solvent Content 48.58

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pcr

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch