.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pc9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of ATP-Dependent Phosphoenolpyruvate Carboxykinase From Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2pc9 Target Id ttk003000460.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14371, Molecular Weight 59311.39 Da.
    Residues 529 Isoelectric Point 6.28
    Sequence mqrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvrepevegei wwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvtespwhalfarnmfilprr fgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfqrrlvlivgtkyageikksiftvmnylm pkrgvfpmhasanvgkegdvavffglsgtgkttlstdperpligddehgwsedgvfnfeggcyakvirl spehepliykasnqfeailenvvvnpesrrvqwdddsktentrssypiahlenvvesgvaghpraiffl sadaygvlppiarlspeeamyyflsgytarvagtergvtepratfsacfgapflpmhpgvyarmlgeki rkhaprvylvntgwtggpygvgyrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpqell npretwadkeaydqqarklarlfqenfqkyasgvakevaeagprte
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.250
    Matthews' coefficent 2.65 Rfactor 0.213
    Waters 763 Solvent Content 53.66

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 16;ATP (ADENOSINE-5'-TRIPHOSPHATE) x 4
    Metals CA (CALCIUM) x 4

    Jmol

     
    Google Scholar output for 2pc9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch