.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pby

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Glutaminase from Geobacillus kaustophilus HTA426. To be Published
    Site RSGI
    PDB Id 2pby Target Id gka001002125.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12312, Molecular Weight 33965.36 Da.
    Residues 310 Isoelectric Point 5.31
    Sequence ghmlvynqeelvrfveeakqyarygkvadyipalgkanpnelsiaiytpddevvsagdvtvkvtlqsis kiialalvlidrgedevfhkvgmeptdypfhsiakleekpakplnpminagalvvtsmiqggsvserle rllafvrrlagnerisysdevarsefetaflnrslcyflkqhriidedveelmelytkqcaiemtcidl ariglvlaldgrdphsseplmpldvaricktfmvtcgmynssgefaikvgipaksgvsggilaavpgrc gigvfgpalddkgnsltgvkllerlsktyslsif
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.07 Rfree 0.249
    Matthews' coefficent 2.34 Rfactor 0.195
    Waters 515 Solvent Content 47.41

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pby

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch