.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pa6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MJ0232 from Methanococcus jannaschii. To be Published
    Site RSGI
    PDB Id 2pa6 Target Id mja001000232.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13368, Molecular Weight 46816.83 Da.
    Residues 427 Isoelectric Point 5.03
    Sequence mlynmderfeikdivarevidsrgnptvevevitkgngygsaivpsgastgthealelrdkekrfggkg vlmavenvnsiirpeilgydarmqreidtimieldgtpnksrlganailavslavakaaaatakiplyk ylggfnsyvmpvpmmnvinggkhagndldlqefmimpvgatsiseavrmgsevyhvlknvilekygkna vnvgdeggfapplktsrealdlltesvkkagyedevvfaldaaasefykdgyyyvegkkltreelldyy kalvdeypivsiedpfheedfegfamitkeldiqivgddlfvtnverlrkgiemkaanalllkvnqigt lseavdaaqlafrngygvvvshrsgetedttiadlsvalnsgqiktgapargertakynqlirieqelg lskyagrnfrcpf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.186
    Matthews' coefficent 2.69 Rfactor 0.170
    Waters 849 Solvent Content 54.29

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pa6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch