.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p9x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PH0832 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2p9x Target Id pho001000832.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13946, Molecular Weight 11016.15 Da.
    Residues 99 Isoelectric Point 5.27
    Sequence mskgrdiltktiilalrevapgleavleahlratlnsgielayddpqkfkeavsklfgeysarllemvi isklkgrlgedieansleelvseirkiyge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.65 Rfree 0.245
    Matthews' coefficent 2.42 Rfactor 0.219
    Waters 400 Solvent Content 49.19

    Ligand Information
    Ligands ACT (ACETATE) x 2
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 2p9x

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch