The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Enoyl-[acyl-carrier-protein] reductase (NADH) from Aquifex aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2p91 Target Id aae001001552.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12075, Molecular Weight 31489.67 Da.
    Residues 285 Isoelectric Point 7.13
    Sequence mlrklskfsnkgevfmgllegkralitgvanersiaygiaksfhregaqlaftyatpklekrvreiakg fgsdlvvkcdvsldediknlkkfleenwgsldiivhsiayapkeefkggvidtsregfkiamdisvysl ialtrellplmegrngaivtlsyygaekvvphynvmgiakaalestvrylaydiakhghrinaisagpv ktlaaysitgfhllmehttkvnpfgkpitiedvgdtavflcsdwaraitgevvhvdngyhimgvfgree eikkevygd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.197
    Matthews' coefficent 2.03 Rfactor 0.167
    Waters 644 Solvent Content 39.29

    Ligand Information


    Google Scholar output for 2p91

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch